Delivered-To: info@designerliving.com Received: by 2002:a05:6214:3506:b0:531:d925:87f6 with SMTP id nk6csp108085qvb; Fri, 13 Jan 2023 19:15:38 -0800 (PST) X-Google-Smtp-Source: AMrXdXsRqU6t68Ra3V6PLVEC/YRR8sZhYOrGrZzJIU3Jd0nNat/baLAzkYPf7dz6WI6vMPk3qsdN X-Received: by 2002:a05:622a:4896:b0:3a6:ee87:20ed with SMTP id fc22-20020a05622a489600b003a6ee8720edmr33643955qtb.0.1673666138143; Fri, 13 Jan 2023 19:15:38 -0800 (PST) ARC-Seal: i=1; a=rsa-sha256; t=1673666138; cv=none; d=google.com; s=arc-20160816; b=tVK3Yi76lWoRRwq2pDCGMS+4Ms5cgZTTpJIBnd5tsbxDRhirYtdffSXilNjtydegK9 VwlhL99brBvql9WJJV2X8QUx5ZaGFopP2Cwamty590EPGN2d4wyVCW+yUHVApl816ysC GV9xH06ozva1/q1xyl3nGA4muMWZu8pf6zy+q2Y81RLm9NEhjEXKxqZ3Xi5Vh5f3FH+7 Pgx2Cj6dkpiE+11EltctQgxBYaMsQnCFx4nQx40VjyGu3LHO/rZnpAbMzWeDi1Fn0CqX cyifUPdx8uHl7wRu6A2nqIBoAzxW0o0+oG0zIogJ8LYSo9KIJdEDd1j+tm/ILI0IBPoV kpXA== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=importance:mime-version:subject:message-id:to:from:date :dkim-signature; bh=hIepN3/PbD75eWxmt+K5v8mZAym/+ZQgXrcKGR9W00I=; b=WlvjaiVgwj9zOeTBO/SUvMqTxeoGDdYMxkUtNzyH8oWYkKUlblvaKiDMdAExlct9RS G9UXXhHc38v25K+y9UxcZHOn/cVY4GFfPTL9Zx9rPXrnjupByddMEpCD6u75WH7NSFt6 ax0wXwHh0H5/CrmrtfBJfXfNmh3YPn7a5gm+Hrfo5GduEHZwepTaATxKL3tm3xbKmUit qXdFAfBqgNehsscvkT9JawknIsEiqS2GLkKw00l+8fVMdRFhP+ZbrlxF2ZEpKqDIHEtd M4Tam7vZvWF3QFzXQV/FChcJlKk60S73O0iuJCaLNQm71ozBjCndsXJ1G60nWAAXrZ16 mpcw== ARC-Authentication-Results: i=1; mx.google.com; dkim=pass header.i=@comcast.net header.s=20190202a header.b=xGrciUQP; spf=pass (google.com: domain of russell366@comcast.net designates 2001:558:fd01:2bb4::2 as permitted sender) smtp.mailfrom=russell366@comcast.net; dmarc=pass (p=NONE sp=NONE dis=NONE) header.from=comcast.net Return-Path: Received: from resqmta-a1p-077436.sys.comcast.net (resqmta-a1p-077436.sys.comcast.net. [2001:558:fd01:2bb4::2]) by mx.google.com with ESMTPS id ea10-20020a05620a488a00b00705f5029cf9si4787253qkb.55.2023.01.13.19.15.38 for (version=TLS1_2 cipher=ECDHE-ECDSA-AES128-GCM-SHA256 bits=128/128); Fri, 13 Jan 2023 19:15:38 -0800 (PST) Received-SPF: pass (google.com: domain of russell366@comcast.net designates 2001:558:fd01:2bb4::2 as permitted sender) client-ip=2001:558:fd01:2bb4::2; Authentication-Results: mx.google.com; dkim=pass header.i=@comcast.net header.s=20190202a header.b=xGrciUQP; spf=pass (google.com: domain of russell366@comcast.net designates 2001:558:fd01:2bb4::2 as permitted sender) smtp.mailfrom=russell366@comcast.net; dmarc=pass (p=NONE sp=NONE dis=NONE) header.from=comcast.net Received: from resomta-a1p-077252.sys.comcast.net ([96.103.145.241]) by resqmta-a1p-077436.sys.comcast.net with ESMTP id GVk1pX1UvdaYlGX17phupS; Sat, 14 Jan 2023 03:15:37 +0000 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=20190202a; t=1673666137; bh=hIepN3/PbD75eWxmt+K5v8mZAym/+ZQgXrcKGR9W00I=; h=Received:Received:Date:From:To:Message-ID:Subject:MIME-Version: Content-Type:Xfinity-Spam-Result; b=xGrciUQPc0mqSKjKFLwTbt6BR9bdCHwYk2jhPOdZWCKcw6vclsK+9wRReBBltm14E ahJMu7b4STKnigKnVvrIpzWNvHfVvWGm3oGCd3rq/RLzNY5Z1oN29P3WmWkTISTyk7 JSDehEuqMtI9dveJrloDjkQWphBluc1vlAgyg4QouPXAQTKBG57qbPKTZGZsreQ/gy +qVMXhwOM3trEiSacaEK/Hoqw8/SsaacOt3trNGwX73HxlVIicC/NqD57l4c3MgX/r vaRxbQqY27y0y/8v2TC5omH4MKgUL6+c0yyABT3OPdBKfjCbyBtfSQ2U1Ac+nPujD6 CvOmI4fV6gOIg== Received: from oxapp-ch2g-60o.email.comcast.net ([96.118.129.115]) by resomta-a1p-077252.sys.comcast.net with ESMTPS id GX17pU9D92JKIGX17pVpLo; Sat, 14 Jan 2023 03:15:37 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedvhedrleelgdehlecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfdppffquffrtefokffrnecuuegrihhlohhuthemuceftddunecugfhmphhthicushhusghjvggtthculddutddmnecujfgurhepfffhvffkufggtgfrkgfoihesrgdtsggsredtjeenucfhrhhomheplffgtefpucftfgfuuffgnffnuceorhhushhsvghllhefieeisegtohhmtggrshhtrdhnvghtqeenucggtffrrghtthgvrhhnpeeuuefgkeeuueekveelteffhedvieduvddttdethfetieehheehieejleeiheefffenucfkphepleeirdduudekrdduvdelrdduudehpddujeegrdduiedurdegrdekfeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhephhgvlhhopehogigrphhpqdgthhdvghdqiedtohdrvghmrghilhdrtghomhgtrghsthdrnhgvthdpihhnvghtpeeliedruddukedruddvledrudduhedpmhgrihhlfhhrohhmpehruhhsshgvlhhlfeeiieestghomhgtrghsthdrnhgvthdpnhgspghrtghpthhtohepuddprhgtphhtthhopehinhhfohesuggvshhighhnvghrlhhivhhinhhgrdgtohhm X-Xfinity-VMeta: sc=10.00;st=legit Date: Fri, 13 Jan 2023 22:15:37 -0500 (EST) From: JEAN RUSSELL To: "info@designerliving.com" Message-ID: <551751976.842919.1673666137405@connect.xfinity.com> Subject: MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="----=_Part_842918_2093407341.1673666137368" X-Priority: 3 Importance: Normal X-Mailer: Open-Xchange Mailer v7.10.5-Rev21 X-Originating-IP: ::ffff:174.161.4.83 X-Originating-Client: open-xchange-appsuite ------=_Part_842918_2093407341.1673666137368 MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 7bit Manager, I am a 61-year-old single mom of a 22-year-old daughter and 7-year-old granddaughter. My daughter is a CNA and also a single mom and struggles to support herself and my granddaughter. I am on disability and don't have money to help them out. The only thing I can do to help my daughter out is to pick up my granddaughter from school, help her with her homework, feed her and watch her till my daughter gets off work. With the price of groceries and gas I am really struggling right now. My daughter's birthday is coming up on the 4th. She is in need of a queen size sheet set. My granddaughter occassionally pees in the bed and it leaks out of her diaper so she has to wash her sheets a lot. Is there any way you could find it in your heart to donate one of your satin luxury 6 piece sets which my granddaughter can give to her for her birthday. I realize I'm asking a lot as we are all struggling right now, but had to give it a try. Thank you and God bless you Jean Russell 366 Cedar View Way Knoxville, TN 37919 ------=_Part_842918_2093407341.1673666137368 MIME-Version: 1.0 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: 7bit
Manager,

I am a 61-year-old single mom of a 22-year-old daughter and 7-year-old granddaughter.

My daughter is a CNA and also a single mom and struggles to support herself and my granddaughter.

I am on disability and don't have money to help them out. The only thing I can do to help my daughter out is to pick up my granddaughter from school, help her with her homework, feed her and watch her till my daughter gets off work. With the price of groceries and gas I am really struggling right now.

My daughter's birthday is coming up on the 4th.  She is in need of a queen size sheet  set.   My granddaughter occassionally pees in the bed and it leaks out of her diaper so she has to wash her sheets a lot.  Is  there any way you could find it in your heart to donate one of your satin luxury 6 piece sets  which my granddaughter can give to her for her birthday.

I realize I'm asking a lot as we are all struggling right now, but had to give it a try.

Thank you and God bless you

Jean Russell
366 Cedar View Way
Knoxville, TN 37919
------=_Part_842918_2093407341.1673666137368--